Home
 What's New
 About
 Contribute
 Preface
 Introduction
 Fish Anatomy
 Water Chemistry
 The Aquarium
 Plant Care
 Plant Species
 Food
 Disease
 Biotope Aquaria
   Ecosystems
   Country Database
 Fish Species
   Catfish
   Characins
   Cichlids
   Cyprinds
   Killifish
   Labyrinth Fish
   Livebearers
   Loaches
   Others
   Perches
   Rainbowfish
 Non-fish Species
 Breeding Fish
 Aquarium Photos
 Bibliography
 Links
 Resources
 Rainforests
 Books
 Site Map
 Mongabay Sites
   Animal Photos
   Conservation
   Travel Tips
 Contact





Web Resources for Caelorinchus kishinouyei

FishBase profile for Caelorinchus kishinouyei

DNA Structural Analysis of Sequenced Microbial Genomes: Atlases for Caelorinchus kishinouyei mtDNA strain. Genome Atlas for Caelorinchus kishinouyei mtDNA (CIR). Structure Atlas for Caelorinchus ...
http://www.cbs.dtu.dk/services/GenomeAtlas/show-origin.php?segmentid=Ckishinouyei_Strain_mtDNA

DNA Structural Analysis of Sequenced Microbial Genomes: 00:51. Genome Atlas Origin of Replication (for Caelorinchus kishinouyei) has been accessed 3 times since 2004-05-18 13:27:49. Total ...
http://www.fishbase.org/identification/specieslist.cfm?famcode=185&areacode=

Family - Search Result: Caelorinchus kermadecus, Kermadec rattail, Caelorinchus kishinouyei, Mugura grenadier, 36.0 TL. Caelorinchus labiatus, Spearsnouted grenadier, 50.0 TL. ...
http://www.fishbase.org/ListByLetter/ScientificNamesC.htm

Scientific Name - Search Result, ALPHABETICAL: Caelorinchus karrerae. Caelorinchus kermadecus. Caelorinchus kishinouyei. Caelorinchus labiatus. Caelorinchus lasti. Caelorinchus longicephalus. ...
http://www.funet.fi/pub/sci/bio/life/pisces/actinopterygii/gadiformes/macrouridae/macrourinae/caelorinchus/

Caelorinchus: Caelorinchus kishinouyei Jordan & Snyder, 1900 Coelorhynchus kishinouyei Jordan & Snyder, 1900; (valid as) Caelorinchus kishinouyei Okamura, 1984 Coelorinchus ...
http://fishdb.sinica.edu.tw/2001new/fishpic.asp?gen=Caelorinchus&spe=kishinouyei

Caelorinchus kishinouyei: ...å­¸å??, Caelorinchus kishinouyei, 命å??者, Jordan et Snyder, 1900. 中文 å??, 岸上æ°?è…”å?»é±ˆ. 科中文å??, 鼠尾鱈科. 科號科å??, 205 Macrouridae. ...
http://fishdb.sinica.edu.tw/2001new/classification/class_new.asp?fa=Macrouridae&fach=%E9%95%B7%E5%B0%BE%E9%B1%88%E7%A7%91

Folder Navigation: ...- [ Translate this page ] ... Caelorinchus karrerae 大紅腔�鱈¡@Caelorinchus kermadecus 胸斑腔�鱈�( 岸上�鬚鱈)¡@Caelorinchus kishinouyei 矛�腔�鱈¡@Caelorinchus ...
http://www.ebi.ac.uk/genomes/organelle.html

Genomes Pages - Organelle: Caelorinchus kishinouyei. 52, Caelorinchus kishinouyei mitochondrion, 15,942, AP002929, AP002929, 13 FASTA SRS. Caenorhabditis elegans. ...
http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=165362

ITIS Standard Report Page: Caelorinchus: Species, Caelorinchus kermadecus (Jordan and Gilbert in Jordan and Starks, 1904), Species, Caelorinchus kishinouyei (Jordan and Snyder, 1900) -- Mugura whiptail, ...
http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=author&search_id=author_id&search_id_value=20117

ITIS 'Taxon Author(s)' Search results citing "Jordan and Snyder ...: Kingdom Animalia. Areliscus Jordan and Snyder, 1900 -- invalid. Caelorinchus kishinouyei (Jordan and Snyder, 1900) -- valid -- Mugura whiptail. ...
http://www.fishbase.org.ph/References/SpeciesUsedRefList.cfm?refno=48147

List of Species Treated in Reference and Used in FishBase: Caelorinchus kamoharai Matsubara, 1943, Caelorinchus kamoharai (p. 595). Caelorinchus kishinouyei Jordan & Snyder, 1900, Caelorinchus kishinouyei (p. 595). ...
http://club.pep.ne.jp/~bigfish/fishes/moku/Gadiformes.htm

タラ目 Gadiformes: Caelorinchus kermadecus, Jordan & Gilbert, 1904, Kermadec rattail. Caelorinchus kishinouyei, Jordan & Snyder, 1900, Mugura grenadier. ...
http://morag.umsmed.edu/blast/catfish/blastresultsJx17/IpuJx17_2_C02_Sport5-2_19May01_018.html

BLAST Search Results: Sbjct: 67 FFMVMPVMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPP 107 >ref|NP_443348.1| (NC_003169) cytochrome c oxidase subunit I [Caelorinchus kishinouyei] dbj|BAB70159.1 ...
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=search&db=nucleotide&term=NC_003169&qty=1

Entrez Nucleotide: Caelorinchus kishinouyei mitochondrion, complete genome gi|16357248|ref|NC_003169.1|[16357248]. ...
http://www.ncbi.nlm.nih.gov/genomes/framik.cgi?gi=15817&db=G

Genomes: Caelorinchus kishinouyei mitochondrion, complete genome Accession: NC_003169 Total Bases Sequenced: 15942 bp Completed: Oct 19, 2001. ...
http://www.gwdg.de/service/info-all/gen-sequenz/db_metazoa_mito_link.html

mitochondriale Gensequenzen (Metazoen): Brugia malayi. Bufo melanostictus. Buteo buteo. Caelorinchus kishinouyei. Caenolestes fuliginosus. Caenorhabditis elegans. Caiman crocodilus. Canis familiaris. ...
http://bioinf.man.ac.uk/ogre/searchresults.shtml?searchstring=%5BA-Za-z0-9%5C-%5D

OGRe. search results: ...lanceolatum amphioxus - mtDNA Buteo buteo common buzzard - mtDNA Caenorhabditis elegans roundworm - mtDNA Caelorinchus kishinouyei Mugura grenadier - mtDNA ...
http://bioinf.man.ac.uk/ogre/geneorders.shtml

OGRe. gene orders: ...bioinf.man.ac.uk/ogre/geneorders.shtml - 24k - Cached - Similar pages[ More results from bioinf.man.ac.uk ] Protein Page for RRC00609 from Rhodobacter capsulatus ... Phoxinus erythrogaster, pirnr|NF00841521, 2.02e-21, 725, NADH dehydrogenase subunit 5, Caelorinchus kishinouyei, pirnr|NF00384797, 6.13 ...
http://www.ergo-light.com/ERGO/CGI/prot.cgi?prot=RRC00609&user=

Protein Page for RRC00609 from Rhodobacter capsulatus: Phoxinus erythrogaster, pirnr|NF00841521, 2.02e-21, 725, NADH dehydrogenase subunit 5, Caelorinchus kishinouyei, pirnr|NF00384797, 6.13 ...
http://megasun.bch.umontreal.ca/ogmp/projects/other/compare.html

comparison tables with NCBI: 60, Buteo buteo, NC_003128, 18674, AF380305. 61, Caelorinchus kishinouyei, NC_003169, 15942, AP002929. 62, Caenorhabditis elegans, NC_001328, 13794, MTCE. ...
http://megasun.bch.umontreal.ca/ogmp/projects/other/mt_list.html

Complete mitochondrial genome sequences: AF380305, AF380305, 05-OCT-2001, Buteo buteo [Chordata], -. AP002929, AP002929, 19-OCT-2001, Caelorinchus kishinouyei [Chordata], -. CFU508400, ...
http://www.brenda.uni-koeln.de/sequences/seq_tsv_EC_download.php4?ec=1.9.&type=fasta

Q01519 | cytochrome-c oxidase | 1.9.3.1 | Saccharomyces cerevisiae ...: Q94T17 | cytochrome-c oxidase | 1.9.3.1 | Caelorinchus kishinouyei | TREMBL MAHPSQLGFQDAASPLMEELLHFHDHTLMVVFLISTLVLYIIVAMVSTKLTDKLISDSQE ...
http://www.brenda.uni-koeln.de/sequences/seq.php4?ID=9354

NADH2 dehydrogenase (ubiquinone) from Spizellomyces punctatus (1.6 ...: ...www.brenda.uni-koeln.de/sequences/seq.php4?ID=9354 - 101k - Jun 14, 2004 - Cached - Similar pages[ More results from www.brenda.uni-koeln.de ] [PDF] PII: S0378-1119(02)00688-1File Format: PDF/Adobe Acrobat - View as HTML ... lacustre Loach M91245 Cyprinus carpio Carp X61010 Danio rerio Zebrafish AC024175 Paracanthopterygii Gadiformes Caelorinchus kishinouyei Mugura grenadier ...
http://www.biosis.org.uk/ion/results.asp?seek=Caelorinchus%20kishinouyei

Search results: Index To Organism Names: Search Results. Request Details. Searching for : Caelorinchus kishinouyei. Search Results. No results found. Search again. ...
http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB12683-ctaD.blastp

getblast.pl beck@molgen-mpg.de: ...cytochrom... 338 8e-92 SP_TREMBL:Q94T18 Q94t18 caelorinchus kishinouyei (mugura grenadi... 338 9e-92 SP_TREMBL:Q9G7S4 Q9g7s4 sus scrofa (pig). ...
http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB12685-ctaE.blastp

getblast.pl beck@molgen-mpg.de: 47 6e-04 SP_TREMBL:Q94S97 Q94s97 elassoma evergladei (everglades pygmy su... 47 6e-04 SP_TREMBL:Q94T14 Q94t14 caelorinchus kishinouyei (mugura grenadi... ...
http://fishbase.sinica.edu.tw/summary/Speciessummary.cfm?Genusname=Caelorinchus&Speciesname=kishinouyei

Species Summary: Caelorinchus kishinouyei Mugura grenadier, You can sponsor this page, ...
http://srs.pku.edu.cn/srs7bin/cgi-bin/wgetz?-id+lvNB1EbOmM+%5Bsptrembl-ID:Q94T15%5D+-e

Entry Page: 24, Last annotation update) DE ATPase subunit 6 (EC 3.6.3.14) (ATP synthase A chain). GN ATPASE 6. OS Caelorinchus kishinouyei (Mugura grenadier). ...
http://bioinf.bmi.ac.cn/srs71bin/cgi-bin/wgetz?-id+4xSrX1MGB9s+%5Bsptrembl-ID:Q94T15%5D+-e

Entry Page: Description, atpase subunit 6 (EC 3.6.3.14) (atp synthase a chain). Gene name(s), atpase 6. Organism source, Caelorinchus kishinouyei (Mugura grenadier). ...
http://filaman.uni-kiel.de/larvalbase/Eschmeyer/PiscesSummary.cfm?ID=8455

Pisces Reference - Detail: 1990:167 [ref. 18936]). Valid as *Caelorinchus kishinouyei* Jordan & Snyder 1900 -- (Nakabo 2000:432 [ref. ... 26001]). Should be *Caelorinchus kishinouyei*. ...
http://ichtyonb1.mnhn.fr/Photos/ThumbnailsSummary.cfm?ID=8455

tn_Cakis_u0.jpg: Pictures available for Caelorinchus kishinouyei. Google Images (Click on picture to enlarge and see data), FishBase. tn_Cakis_u0.jpg ...
http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=ciona4&id=131936

Protein Pages: Ciona intestinalis (Sea Squirt): ...genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=ciona4&id=131936 - 23k - Cached - Similar pages Protein Pages: Thalassiosira pseudonana (Diatom)genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=thaps1&id=138887 - 26k - Cached - Similar pages OGRe. gene ordersdrake.mcmaster.ca/ogre/geneorders.shtml - 34k - Cached - Similar pages [PDF] A New Species, Caelorinchus sheni , and 19 New Records of ...File Format: PDF/Adobe Acrobat - View as HTML ... A prominent blackish blotch above and behind pectoral fin base .....Caelorinchus kishinouyei 16b. ...
http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=thaps1&id=138887

Protein Pages: Thalassiosira pseudonana (Diatom): ...genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=thaps1&id=138887 - 26k - Cached - Similar pages OGRe. gene ordersdrake.mcmaster.ca/ogre/geneorders.shtml - 34k - Cached - Similar pages [PDF] A New Species, Caelorinchus sheni , and 19 New Records of ...File Format: PDF/Adobe Acrobat - View as HTML ... A prominent blackish blotch above and behind pectoral fin base .....Caelorinchus kishinouyei 16b. ...
http://drake.mcmaster.ca/ogre/geneorders.shtml

OGRe. gene orders: ...drake.mcmaster.ca/ogre/geneorders.shtml - 34k - Cached - Similar pages [PDF] A New Species, Caelorinchus sheni , and 19 New Records of ...File Format: PDF/Adobe Acrobat - View as HTML ... A prominent blackish blotch above and behind pectoral fin base .....Caelorinchus kishinouyei 16b. ...
http://amoebidia.bcm.umontreal.ca/pg-gobase/searches/compilations.php

Compilation Page: ...- [ Translate this page ] ... Caelorinchus kishinouyei, AP002929, 15942, circular, 2, 13, nad1,nad2,nad3,nad4,nad4L,nad5,nad6,cob,cox1,cox2,cox3,atp6,atp8, rnl,rns, 22, 22, 0, 0, 0, ...
http://genomics.nerc-oxford.ac.uk/GMINE/Organelles.GMdata

COUNT*NC_ID*GROUP*SPECIES*SIZE*NA*TYPE*TAX*ORGANISM*SOURCE*DATE 1 ...: 16079*DNA*circular*VRT*Mitochondrion Percopsis transmontana*sand roller.*19-OCT-2001 269*NC_003169*Organelles*Caelorinchus kishinouyei mitochondrion, complete ...
http://www.msi.umn.edu/user_support/compgen/other_genomic.txt




Search the web for further information on Caelorinchus kishinouyei
Google
Web fish.mongabay.com   

Use this form to make suggestions, correct errors, and contribute/submit pictures or content for this species profile.




what's new | tropical fish home | help support the site | search | about | contact

Copyright Rhett Butler 1994-2005

The copy for fish.mongabay.com was written in 1994-1995. Therefore some information such as scientific names may be out of date. For this, I apologize. Feel free to send corrections to me.