|
|
|
|
|
|
Web Resources for Dactyloptena peterseniFishBase profile for Dactyloptena peterseni
http://64.95.130.5/Map/BiogeoModellingV4.cfm?ID=7691 Biogeographic Modelling Tools: Analysis tools: WhyWhere Modelling | Environmental statistics | Web LoiczView |. Dactyloptena peterseni (27 records) Note: Do corrections on both boxes. ... http://www.fishbase.org/Summary/SpeciesSummary.cfm?id=7691 Species Summary: Dactyloptena peterseni Starry flying gurnard, You can sponsor this page, ... http://www.fishbase.org/Summary/SpeciesSummary.cfm?&genusname=Dactyloptena%09%09&speciesname=peterseni www.fishbase.org/Summary/SpeciesSummary.cfm?&genusname=Dactyloptena%09%09&speciesname=peterseni: Similar pages[ More results from www.fishbase.org ] 7691 Dactyloptena peterseni (Nyström, 1887) Dactylopteridae ... ... 7691 Dactyloptena peterseni (Nyström, 1887 ... S 27.9 E ???? Dactyloptena peterseni CAS 66555 -25.1 S 3.8 E ???? Dactyloptena peterseni 95 - 105 m CAS 15942 26. ... http://www.fishbase.org.ph/map/PointData.asp?genus=Dactyloptena&species=peterseni Successful connection, 11 record(s) found. Dactyloptena peterseni ...: Dactyloptena peterseni 7691 Dan jà bà o fáng fú China Main Mandarin Chinese Vernacular Flughahn Germany German Vernacular Flying gurnard Hong Kong English ... http://www.funet.fi/pub/sci/bio/life/pisces/actinopterygii/scorpaeniformes/dactylopteridae/dactyloptena/ Dactyloptena: Dactyloptena peterseni Dactylopterus peterseni Nystræm, 1887; (valid as) Daicocus peterseni Jordan & Richardson, 1908; (valid as) Daicocus peterseni Kyushin ... http://www.cbs.dtu.dk/services/GenomeAtlas/show-codon.php?segmentid=Dpeterseni_Strain_mtDNA DNA Structural Analysis of Sequenced Microbial Genomes: Codon Usage in Dactyloptena peterseni strain Strain. ... Genome Atlas AT content (for Dactyloptena peterseni) has been accessed 35 times since 2004-03-24 15:56:40. ... http://www.cbs.dtu.dk/services/GenomeAtlas/show-atlas.php?segmentid=Dpeterseni_Strain_mtDNA&type=ALL DNA Structural Analysis of Sequenced Microbial Genomes: Atlases for Dactyloptena peterseni mtDNA strain. Genome Atlas for Dactyloptena peterseni mtDNA (CIR). Structure Atlas for Dactyloptena peterseni mtDNA (CIR). ... http://www.cappma.com/dian/search.asp?style=re&zm=D ä¸å›½æ¸”网: Dactyloptena peterseni (Nystrom), å?•æ£˜è±¹é²‚鮄, starry flying gurnard. Dactyloptena peterseni (Nystrom), å?•æ£˜è±¹é²‚鮄, starry helmet gurnard. ... http://en.wikipedia.org/wiki/Dactylopteridae Flying gurnard - Wikipedia: Butterfly flying gurnard (Dactyloptena papilio); Starry flying gurnard (Dactyloptena peterseni); Dactyloptena tiltoni. Genus Dactylopterus: ... http://www.iobis.org/pls/OBISIND/obis_data.obis_search?sciname=D&category=all&names=data&record_set=1 OBIS Search Result: ...of Life. Dactyloptena peterseni Starry flying gurnard a fish 25 [5] - Get OBIS data Y Catalogue of Life; FishBase query Cat. of Life. ... http://www.iobis.org/pls/OBISIND/obis_data.get_obis_data?genus=Dactyloptena&species=peterseni Search result: Search result You searched for distribution of Dactyloptena peterseni your search returns 25 results. about the data sources Data ... http://f15.aaacafe.ne.jp/~ichthy/kasago/k1semi.html セミホウボウ科 Dactylopteridaeï¼?セミホウボウ亜目 ...: 25cm．セミホウボウã?«ä¼¼ã‚‹ã?Œã€?å?»ã?ŒçŸã?„ã?“ã?¨ã?§åŒºåˆ¥ï¼Ž ■ホシ セミホウボウ Starry flying gurnard Dactyloptena peterseni (Nyström, 1887 ... http://www.nebulasearch.com/encyclopedia/article/Flying_gurnard.html Flying gurnard: Starry flying gurnard ( Dactyloptena peterseni ); Dactyloptena tiltoni Genus Dactylopterus : Flying gurnard ( Dactylopterus volitans ) Reference. ... http://www.ebi.ac.uk/genomes/organelle.html Genomes Pages - Organelle: FASTA SRS. Dactyloptena peterseni. 89, Dactyloptena peterseni mitochondrion, 16,717, AP002947, AP002947, 13 FASTA SRS. Dallia pectoralis. 90, ... http://www.gwdg.de/service/info-all/gen-sequenz/db_metazoa_mito_link.html mitochondriale Gensequenzen (Metazoen): Crossostoma lacustre. Cynocephalus variegatus. Cyprinus carpio. Dactyloptena peterseni. Dactyloptena tiltoni. Dallia pectoralis. Danacetichthys galathenus. ... http://encyclopedia.thefreedictionary.com/Flying%20gurnard Flying gurnard information - encyclopedia article about Flying ...: Starry flying gurnard (Dactyloptena peterseni); Dactyloptena tiltoni. Genus Dactylopterus: Flying gurnard (Dactylopterus volitans). Reference. ... http://www.biosis.org.uk/ion/results.asp?seek=Dactyloptena%20peterseni Search results: Index To Organism Names: Search Results. Request Details. Searching for : Dactyloptena peterseni. Search Results. No results found. Search again. ... http://www.infochembio.ethz.ch/links/zool_fische_flughaehne.html Flughähne: Fische: ...- [ Translate this page ] ... Spotwing Flying Gurnard (Dactyloptena macracantha) - Text and Image. Starry Flying Gurnard (Dactyloptena peterseni) - Text and Image. Was ist ein Knurrhahn? ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=search&db=nucleotide&term=NC_003194&qty=1 Entrez Nucleotide: Dactyloptena peterseni mitochondrion, complete genome gi|16357360|ref|NC_003194.1|[16357360]. ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=nucleotide&cmd=search&term=AP002947 Entrez Nucleotide: Dactyloptena peterseni mitochondrial DNA, complete genome gi|16267269|dbj|AP002947.1|[16267269]. ... http://bioinf.man.ac.uk/ogre/searchresults.shtml?searchstring=%5BA-Za-z0-9%5C-%5D OGRe. search results: ...tasseled-mouth loach - mtDNA Cynocephalus variegatus Malayan flying lemur - mtDNA Cyprinus carpio common carp - mtDNA Dactyloptena peterseni starry flying ... http://bioinf.man.ac.uk/ogre/geneorders.shtml OGRe. gene orders: ...bioinf.man.ac.uk/ogre/geneorders.shtml - 24k - Cached - Similar pages[ More results from bioinf.man.ac.uk ] BLAST Search Results - [ Translate this page ] ... 242 Query: 727 Y 729 Y Sbjct: 243 Y 243 >ref|NP_443673.1| (NC_003194) cytochrome c oxidase subunit I [Dactyloptena peterseni] dbj|BAB70393.1| (AP002947 ... http://morag.umsmed.edu/blast/catfish/blastresultsJx17/IpuJx17_1_A10_Sport5-2_19May01_081.html BLAST Search Results: ...- [ Translate this page ] ... 242 Query: 727 Y 729 Y Sbjct: 243 Y 243 >ref|NP_443673.1| (NC_003194) cytochrome c oxidase subunit I [Dactyloptena peterseni] dbj|BAB70393.1| (AP002947 ... http://morag.umsmed.edu/blast/catfish/blastresultsJx14/IpuJx14_16_A08_23_16Apr02_065.html BLAST Search Results: ...- [ Translate this page ] ... Sbjct: 186 AVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGG 225 >ref|NP_443673.1| (NC_003194) cytochrome c oxidase subunit I [Dactyloptena peterseni] dbj|BAB70393.1 ... http://www.nis.gov.jo/biodiversity/marinefish.htm Marine Fishes: Family Acropomatidae. Acropoma japinicus Family Actylopteridae. Dactyloptena peterseni Family Antennaridae. Antennarius commersoni Family Apogonidae. ... http://megasun.bch.umontreal.ca/ogmp/projects/other/compare.html comparison tables with NCBI: 126, Cyprinus carpio, NC_001606, 16575, MICCCG. 127, Dactyloptena peterseni, NC_003194, 16717, AP002947. 128, Dactyloptena tiltoni, NC_004402, 16751, AP004440. ... http://megasun.bch.umontreal.ca/ogmp/projects/other/mt_list.html Complete mitochondrial genome sequences: MICCCG, X61010, 29-JUL-1994, Cyprinus carpio [Chordata], -. AP002947, AP002947, 19-OCT-2001, Dactyloptena peterseni [Chordata], -. AP004440, ... http://www.brenda.uni-koeln.de/sequences/seq_tsv_EC_download.php4?ec=1.9.&type=fasta Q01519 | cytochrome-c oxidase | 1.9.3.1 | Saccharomyces cerevisiae ...: Q94SD9 | cytochrome-c oxidase | 1.9.3.1 | Dactyloptena peterseni | TREMBL MAHPSQLGFQDAASPVMEELLHFHDHALMIVFLISALVLYIIVAMVTTKLTNKFLLDSQE ... http://www.brenda.uni-koeln.de/sequences/seq.php4?ID=9354 NADH2 dehydrogenase (ubiquinone) from Spizellomyces punctatus (1.6 ...: ...www.brenda.uni-koeln.de/sequences/seq.php4?ID=9354 - 101k - Jun 14, 2004 - Cached - Similar pages[ More results from www.brenda.uni-koeln.de ] List of Species Treated in Reference and Used in FishBase - [ Translate this page ] ... Dactyloptena orientalis (Cuvier, 1829), Dactyloptena orientalis (p. 88). Dactyloptena peterseni (Nyström, 1887), Dactyloptena peterseni (p. 89). ... http://filaman.uni-kiel.de/References/SpeciesUsedRefList.cfm?refno=5213 List of Species Treated in Reference and Used in FishBase: ...- [ Translate this page ] ... Dactyloptena orientalis (Cuvier, 1829), Dactyloptena orientalis (p. 88). Dactyloptena peterseni (Nyström, 1887), Dactyloptena peterseni (p. 89). ... http://filaman.uni-kiel.de/References/SpeciesUsedRefList.cfm?refno=33390 List of Species Treated in Reference and Used in FishBase: ...- [ Translate this page ] ... Dactyloptena orientalis (Cuvier, 1829), Dactyloptena orientalis (p. 168). Dactyloptena peterseni (Nyström, 1887), Dactyloptena peterseni (p. 169). ... http://fishbase.sinica.edu.tw/References/SpeciesUsedRefList.cfm?refno=33390 List of Species Treated in Reference and Used in FishBase: Dactyloptena orientalis (Cuvier, 1829), Dactyloptena orientalis (p. 168). Dactyloptena peterseni (Nystrom, 1887), Dactyloptena peterseni (p. 169). ... http://fishbase.sinica.edu.tw/Photos/ThumbnailsSummary.cfm?ID=7691 tn_Dapet_u0.jpg: Pictures available for Dactyloptena peterseni. Google Images (Click on picture to enlarge and see data), FishBase. tn_Dapet_u0.jpg ... http://amol.org.au/collection/hostedwebs/fish/key/fish_species_listC.html Australian Fish Species: Dactyloptena orientalis (Cuvier, 1829). Dactyloptena papilio Ogilby, 1910. Dactyloptena peterseni (Nyström, 1887). FAMILY PEGASIDAE. ... http://infopedia.ruv.net/fl/Flying_gurnard.html Flying gurnard - Wikipedia: Butterfly flying gurnard[?] (Dactyloptena papilio); Starry flying gurnard[?] (Dactyloptena peterseni); Dactyloptena tiltoni. Genus Dactylopterus: ... http://www.idive.co.il/printable.asp?ArticleID=439 Yam Magazine by Nana Portal: ...× ×¦×™×’×™×? למשפחה בישר×?ל: ×”×?חד, הטיר ×”×™×?-סופי ×©×©× ×™ ×¡× ×¤×™×¨×™ הגב שלו ,(Dactyloptena peterseni) סמוכי×? ×–×” ... http://walnut.bioc.columbia.edu/srs6bin/cgi-bin/wgetz?-id+on291EKHQt+%5Bswissprot-AccNumber:Q94SD0%5D+-e Entry Page: Description, cytochrome b. Gene name(s), mtcyb or cob or cytb. Organism source, Dactyloptena peterseni (Starry flying gurnard). Organism ... http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB4646-cox3.blastp getblast.pl beck@molgen-mpg.de: ...cytochrome oxidase su... 36 0.27 SP_TREMBL:Q94SD6 Q94sd6 dactyloptena peterseni (starry flying gu... 36 0.27 SP_TREMBLNEW:AAL91055 Aal91055 roboastra europaea. ... http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB12685-ctaE.blastp getblast.pl beck@molgen-mpg.de: 47 6e-04 SP_TREMBLNEW:BAC23469 Bac23469 anomalops katoptron (splitfin fla... 47 6e-04 SP_TREMBL:Q94SD6 Q94sd6 dactyloptena peterseni (starry flying gu... ... http://srs.pku.edu.cn/srs7bin/cgi-bin/wgetz?-id+lvNB1EbOmM+%5Bsptrembl-ID:Q94SD7%5D+-e Entry Page: 24, Last annotation update) DE ATPase subunit 6 (EC 3.6.3.14) (ATP synthase A chain). GN ATPASE 6. OS Dactyloptena peterseni (Starry flying gurnard). ... https://mcluster.tu-graz.ac.at/srs71bin/cgi-bin/wgetz?-id+4xStq1MbAgR+%5Bsptrembl-ID:Q94SD7%5D+-e Entry Page: Description, atpase subunit 6 (EC 3.6.3.14) (atp synthase a chain). Gene name(s), atpase 6. Organism source, Dactyloptena peterseni (Starry flying gurnard). ... http://srs.csc.fi/srs7bin/cgi-bin/wgetz?-id+7BJRi1M67id+%5Bsptrembl-ID:Q94SD4%5D+-e Entry Page: Keywords, Mitochondrion;. Description, nadh dehydrogenase subunit 4l. Gene name(s), nd4l. Organism source, Dactyloptena peterseni (Starry flying gurnard). ... http://www.scbit.org/srs7bin/cgi-bin/wgetz?-id+1dMGZ1M9GbQ+%5Bsptrembl-ID:Q94SD7%5D+-e Entry Page: Description, atpase subunit 6 (EC 3.6.3.14) (atp synthase a chain). Gene name(s), atpase 6. Organism source, Dactyloptena peterseni (starry flying gurnard). ... http://www.scbit.org/srs7bin/cgi-bin/wgetz?-id+1dMGZ1M9GbQ+%5Bsptrembl-ID:Q94SD0%5D+-e Entry Page: Mitochondrion;. Description, cytochrome b. Gene name(s), cytb or cyt b. Organism source, Dactyloptena peterseni (starry flying gurnard). Organism ... http://zeon.well.ox.ac.uk/srs6bin/cgi-bin/wgetz?-id+4xSuZ1MLXfN+%5Bswissprot-ID:CYB_DACPE%5D+-e Entry Page: 42, Last annotation update) DE Cytochrome b. GN MTCYB OR COB OR CYTB. OS Dactyloptena peterseni (Starry flying gurnard). OG Mitochondrion. ... http://www.kazusa.or.jp/cyanobase/Synechocystis/blast2/nr/sll1925.html Synechocystis: BLAST2 result: 277 Query: 167 TKFL 170 + L Sbjct: 278 IRIL 281 >ref|NP_443680.1| NADH dehydrogenase subunit 4 [Dactyloptena peterseni] gi|16267279|dbj|BAB70400.1| NADH ... http://www.china-fishery.net/fdis2003/exact_search.asp?SearchType=english&ExactKey=Starry+flying+gurnard 猎渔è¯?霸——渔业生物è¯?æ?¡ç²¾ç¡®æŸ¥è¯¢: ...精确查询： ä¸æ–‡å¦å?? 拉ä¸?å¦å?? 英文å??. 您查询的æ?¡ä»¶æ˜¯è‹±æ–‡å??：Starry flying gurnard, ... http://www.genomics.purdue.edu/~jxu/Fgr/CM/blast/Fgr-CM_2_L21_T3.blastx.html NCBI BLAST Search Results: F Sbjct: 445 SNSSIFSRSKIGYRFPLAVVQEATDNFSENRVIGIGGFGKVYKGVF 490 >ref|NP_443672.1| (NC_003194) NADH dehydrogenase subunit 2 [Dactyloptena peterseni] dbj|BAB70392 ... http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=ciona4&id=134448 Protein Pages: Ciona intestinalis (Sea Squirt): ...genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=ciona4&id=134448 - 23k - Cached - Similar pages COUNT*NC_ID*GROUP*SPECIES*SIZE*NA*TYPE*TAX*ORGANISM*SOURCE*DATE 1 ... ... 16498*DNA*circular*VRT*Mitochondrion Mastacembelus favus*tire track eel.*19-OCT-2001 294*NC_003194*Organelles*Dactyloptena peterseni mitochondrion, complete ... http://genomics.nerc-oxford.ac.uk/GMINE/Organelles.GMdata COUNT*NC_ID*GROUP*SPECIES*SIZE*NA*TYPE*TAX*ORGANISM*SOURCE*DATE 1 ...: 16498*DNA*circular*VRT*Mitochondrion Mastacembelus favus*tire track eel.*19-OCT-2001 294*NC_003194*Organelles*Dactyloptena peterseni mitochondrion, complete ... http://fishdb.sinica.edu.tw/2001new/english/eclassification/eclass_new.asp?fa=Dactylopteridae Folder Navigation: Fish Classification System of the World ... Icon Taiwanese Species Class Actinopterygii Subclass Neopterygii Order Scorpaeniformes Suborder Dactylopteroidei, ... http://fishdb.sinica.edu.tw/2001new/fishname.asp?fa=Dactylopteridae 檢索表: ...å¸å??, ä¸æ–‡å??, 命å??者, 標本照. Dactyloptena peterseni, çš®æ°? è±¹é´é®„, (Nyström, 1887), Dactyloptena gilberti, å?‰æ°?è±¹é´é®„, Snyder, 1909, ... http://drake.mcmaster.ca/ogre/compare.shtml OGRe. genome comparison: ...drake.mcmaster.ca/ogre/compare.shtml - 58k - Cached - Similar pages [PDF] Marine Fish Fauna in Hong Kong WatersFile Format: PDF/Adobe Acrobat - View as HTML ... petimba # 1,2,3,4,18,19,20,30,37 Scorpaeniformes Dactylopteridae Dactyloptena gilberti # 1,30,37 Dactyloptena orientalis # 3 Dactyloptena peterseni # 4,30 ... http://cricketweb.bio.tokushima-u.ac.jp/cgi-bin/getCloneBlast?pAP000_H01.ab1 Search the web for further information on Dactyloptena peterseni Use this form to make suggestions, correct errors, and contribute/submit pictures or content for this species profile. |
