|
|
|
|
|
|
Web Resources for Electrophorus electricusFishBase profile for Electrophorus electricus
http://animaldiversity.ummz.umich.edu/site/accounts/pictures/Electrophorus_electricus.html ADW: Electrophorus electricus: Classification: Electrophorus electricus (electric eel). ... electric eel Electrophorus electricus, electric eel Electrophorus electricus, electric eel Electrophorus electricus. ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=163322 ITIS Standard Report Page: Electrophorus electricus: Go to Print Version, Electrophorus electricus (Linnaeus, 1766) Taxonomic Serial No.: 163322. ... Species, Electrophorus electricus (Linnaeus, 1766) -- electric eel, ... http://www.itis.usda.gov/servlet/SingleRpt/SingleRpt?search_topic=TSN&search_value=163324 ITIS Standard Report Page: Gymnotus electricus: Taxonomic Rank: Species, Common Name(s): Valid Name: Electrophorus electricus (Linnaeus, 1766), Taxonomic Status: Current Standing: invalid - junior synonym, ... http://www.netroglycerine.com/links/electrophoruselectricus.html electrophorus electricus: ...electrophorus electricus. electrophorus electricus Looking for something like "electrophorus electricus"? For detailed information ... http://www.fishbase.org/Summary/SpeciesSummary.cfm?genusname=Electrophorus&speciesname=electricus Species Summary: Electrophorus electricus Electric eel, Book produced in collaboration with FishBase. ... http://www.fishbase.org/Summary/SpeciesSummary.cfm?&genusname=Electrophorus%09%09&speciesname=electricus www.fishbase.org/Summary/SpeciesSummary.cfm?&genusname=Electrophorus%09%09&speciesname=electricus: Similar pages[ More results from www.fishbase.org ] genus Electrophorus- -HOMEPAGE, Electrophorus. T" "Electrophorus electricus species: Electrophorus electricus. Mapping project, books about Electrophorus ... http://www.omne-vivum.com/c/20237.htm Primary structure of Electrophorus electricus sodium channel ...: Primary structure of Electrophorus electricus sodium channel deduced from cDNA sequence. Noda M, Shimizu S, Tanabe T, Takai T, Kayano ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=7441723&dopt=Abstract Inactivation (desensitization) of the acetylcholine receptor in ...: Inactivation (desensitization) of the acetylcholine receptor in Electrophorus electricus membrane vesicles by carbamylcholine: comparison between ion flux and ... http://www.funet.fi/pub/sci/bio/life/pisces/actinopterygii/gymnotiformes/electrophoridae/electrophorus/ Electrophorus: Electrophorus electricus Gill, 1864 Gymnotus electricus Linnaeus, 1766; (valid as) Gymnotus regius Chiaje, 1847; (synonym) Electrophorus multivalvulus Nakashima ... http://64.95.130.5/Map/OccurrenceTSAMapList.cfm?ID=4535&GenusName=Electrophorus&SpeciesName=electricus Occurrence Map List: Electrophorus electricus List of Point Data from FishBase and BiOSC ... Electrophorus electricus, 1984, 0.83, -66.17, AMNH 96657, CW MYERS, LS FORD, DEPTO. ... http://64.95.130.5/Map/BiogeoModellingV4.cfm?ID=4535 Biogeographic Modelling Tools: Analysis tools: WhyWhere Modelling | Environmental statistics | Web LoiczView |. Electrophorus electricus (90 records) Note: Do corrections on both boxes. ... http://www.amazon-exotic-import.de/Gallerie/Sonstige/Seiten/Electrophorus%20electricus.htm Electrophorus electricus: Sonstige / Miscellaneous: "Electrophorus electricus". 22.08.03. ... http://www.aquabase.org/fish/view.php3?id=688 AquaBase.org > Poisson > Electrophorus electricus: ...- [ Translate this page ] ... Poisson : Electrophorus electricus Date de création : 08 sep 2003 21:08 par JakezDaniel Dernière modification : 09 sep 2003 19:11 par JTangany, ... http://www.zoovienna.at/old/zitteraal.html Zitteraal (Electrophorus electricus): ...- [ Translate this page ]Zitteraal (Electrophorus electricus). Familie: Elektrische Aale (Electrophoridae) Verbreitung: Südamerika, Orinoko und Amazonas Länge: bis 2,80 Meter. ... http://www.animals-online.be/fish/karperachtigen/electric_eel.html Electric Eel (Electrophorus electricus): Fact Sheet: Scientific name. Electrophorus electricus. English name. Electric Eel. Nederlandse naam. Sidderaal. Nom Français. Anguille électrique. Deutsche name. Zitteraal. ... http://www.jjphoto.dk/fish_archive/aquarium/electrophorus_electricus.htm Electrophorus electricus: Origin: River Amazonas basin SOUTH AMERICA, ELECTROPHORUS ELECTRICUS (Linnaeus, 1766) Family: Gymnotidae Order: Gymnotiformes, Water Type: Fresh 23-28ºC / pH 7 ... http://www.aquariacentral.com/species/db.cgi?db=fresh&uid=default&ID=0403&view_records=1 The Electric Eel - Electrophorus electricus: Electric Eel. Electrophorus electricus (Linnaeus, 1766). Temperment, Sociability, Min. Tank, Availability, Area. Aggressive, Solitary, 500 gallons, Rare, All Ranges. ... http://filaman.uni-kiel.de/Country/CountrySpeciesSummary.cfm?Country=Suriname&Genus=Electrophorus&Species=electricus Country Species Summary: Electrophorus electricus in Suriname Electric eel. ... http://filaman.uni-kiel.de/Country/CountrySpeciesSummary.cfm?Country=Guyana&Genus=Electrophorus&Species=electricus filaman.uni-kiel.de/Country/CountrySpeciesSummary.cfm?Country=Guyana&Genus=Electrophorus&Species=electricus: Similar pages[ More results from filaman.uni-kiel.de ] Ingenta: Article Summary -- Arrhenius Analysis of the ... ... Arrhenius Analysis of the Electrophorus Electricus Acetylcholinesterase-Catalyzed Hydrolysis of Acetylthiocholine Protein and Peptide Letters June 2003, vol. ... http://www.ingenta.com/isis/searching/ExpandTOC/ingenta?issue=pubinfobike://ben/ppl/2003/00000010/00000003&index=12 Electric eel Electrophorus electricus: First Previous Next Last Index Text. Slide 9 of 28. http://www.life.umd.edu/faculty/wilkinson/BSCI338/L11electrosense/tsld009.htm Electric eel Electrophorus electricus: Electric eel Electrophorus electricus. Electric organ has up to 6000 electrocytes and produces 720 volts. ... http://animalpicturesarchive.com/animal/EngNames/electric_eel.html electric eel (Electrophorus electricus): Animal Pictures Archive's Species Search Start Point. electric eel (Electrophorus electricus) Family: Electrophoridae, Click me to search. ... http://www.webcityof.com/miff1032.htm Master Index of Freshwater Fishes (E - Epiplatys annulatus): ...ahli Electric Blue Kande See Sciaenochromis psammophilus Electric Catfish See Malapterurus electricus Electric Eel See Electrophorus electricus Electric Yellow ... http://www.spibio.com/scientific/publication_spibio.asp SPI-BIO Scientific Section: Compounds labelled by the acetylcholinesterase of Electrophorus Electricus. ... Compounds labelled by the acetylcholinesterase of Electrophorus Electricus. ... http://acd.ufrj.br/dhe/labmus.htm Laboratorio de Diferenciação Muscular e Citoesqueleto: ...- [ Translate this page ] ... Cell Biol., 79: 409-417, 2001. “The cytoskeleton of the electric tissue of Electrophorus electricus, L.â€? Mermelstein, CS, Costa, ML, Moura Neto, V. and ... http://www.uchsc.edu/physiology/srl/srlcv.htm Simon Rock Levinson, Ph.D.: 1978) Purification of the tetrodotoxin binding component associated with the voltage-sensitive sodium channel of Electrophorus electricus electroplax membranes ... http://helium.vancouver.wsu.edu/~ingalls/eels/ Electric Eel: ELECTROPHORUS ELECTRICUS (The Electric Eel). ... Common Name: Electric eel The electric eel, or Electrophorus electricus, is a freshwater fish, not a true eel. ... http://www.floranimal.ru/pages/animal/u/3498.html УГОРЬ ÐЛЕКТРИЧЕСКИЙ: УГОРЬ ÐЛЕКТРИЧЕСКИЙ (Electrophorus electricus). Рыбы коÑ?тные / Карпообразные / Угри ... http://www.sigmaaldrich.com/Area_of_Interest/Biochemicals___Reagents/Enzyme_Explorer/Class_Index/Hydrolases_on_esters.html Enzyme Class Index: Hydrolases on esters: 3.1.1.7, Acetylcholine Esterase Electrophorus electricus (electric eel), Type VS, Lyophilized powder, 1,000-2,000 units/mg protein, C2888. ... http://www.sigmaaldrich.com/Brands/Fluka___Riedel_Home/Organic___Synthetic/Enzymes/Organic_Chemistry/Hydrolases.html Hydrolases: 01022. Acetylcholine Esterase from Electrophorus electricus; ~850 U/mg, 3.1.1.7. 01023. Acetylcholine Esterase from Electrophorus electricus; ~300 U/mg, 3.1.7.1. ... http://jeb.biologists.org/cgi/content/refs/202/10/1229 JEB -- Caputi 202 (10): 1229: Albe-Fessard, D (1954). Novelle etude des latences spinales dans le dispositif de commande des organs electriques chez Electrophorus electricus. Anais Acad. ... http://www.led.uni-stuttgart.de/hfam27.html Homologous family Acetylcholinesterases: Electrophorus electricus, acetylcholinesterase, PDB, 1EEA, Acetylcholinesterase, 1EEAA. Electrophorus electricus, acetylcholinesterase, PDB PDB PDB PDB PDB, ... http://www.musee-afriqueoceanie.fr/pages/page_id18935_u1l2.htm rmn - Les poissons électriques: ...- [ Translate this page ] ... tropical - RMN. Les poissons électriques. Electrophorus electricus, les pores de la ligne latérale sont très visibles. Vivant dans ... http://www.amazonian-fish.co.uk/sternopygidae.html The Fishes: Sternopygidae: ...submerged leaf litter. Electrophoridae This family holds a single species, the famous electric eel, Electrophorus electricus. This is the ... http://hypertextbook.com/facts/BarryLajnwand.shtml Voltage of an Electric Eel: The electric eel (Electrophorus electricus), which is found in South American tropical regions, has the ability to produce powerful electric charges. ... http://www.infochembio.ethz.ch/links/zool_fische_messerfisch.html Messerfische: ...- [ Translate this page ] ... Electric Eel (Electrophorus electricus) - Image. Electric Eel (Electrophorus electricus) - Image. ... Zitteraal (Electrophorus electricus) - Text und Abbildung. ... http://www.biol.lu.se/zoofysiol/Djurartiklar/Elfisk.html Elektriska fiskar: Figuren nedan visar elektrocyter hos en elektrisk Ã¥l (Electrophorus electricus). ... Huvudet av en elektrisk Ã¥l (darrÃ¥l), Electrophorus electricus. ... http://medical.webends.com/kw/Electrophorus Electrophorus: Eel, Electric; Electric Eel; Electrophorus electricus. ... The species Electrophorus electricus is also known as the electric eel, though it is not a true eel. ... http://pedant.gsf.de/cgi-bin/wwwdbp.pl?Db=Ncrassa_annotations&Name=dynrep&String=5329&Title=Ncrassa_annotations&Cmd=Fetch Ncrassa_annotations: Of Rabbit Liver Carboxylesterase In Complex With 4-Piperidino-Piperidine gi|6730113|pdb|1C2B|A Chain A, Electrophorus Electricus Acetylcholinesterase gi|6980490 ... http://pedant.gsf.de/cgi-bin/wwwdbp.pl?Db=Aspergillus_nidulans&Name=dynrep&String=5607&Title=Aspergillus_nidulans&Cmd=Fetch Aspergillus_nidulans: Chain B, Crystal Structure Of The Mouse Acetylcholinesterase- Gallamine Complex gi|6730113|pdb|1C2B|A Chain A, Electrophorus Electricus Acetylcholinesterase gi ... http://vcfw.er.usgs.gov/cgi-bin/iabin/taxon1.pl?which=common_name&item=electric+eel%2C+knife+fish%3B+Electrophorus+electricus US IABIN Node -- European Collections of New World Vertebrates: Search results for Common Name "electric eel, knife fish; Electrophorus electricus". Return to European Collections Home Page Link ... http://encyclopedia.thefreedictionary.com/R.%20T.%20Cox RT Cox - encyclopedia article about RT Cox. Free access, no ...: ...electricus. Binomial name Electrophorus electricus. The electric eel (Electrophorus electricus) is a most unusual species of fish. It ... http://encyclopedia.thefreedictionary.com/Electric%20eel Electric eel - encyclopedia article about Electric eel. Free ...: Click the link for more information. Electrophorus electricus. The electric eel (Electrophorus electricus) is a most unusual species of fish. ... http://www.ava.elacuarista.com/archivos/vzlatemblador.html Temblador: ...- [ Translate this page ]Familia: ELECTROPHORIDAE Nombre CientÃfico: Electrophorus electricus. Nombre Común: Temblador. Esta especie es el conocido “temblador ... http://www.cienciafacil.com/pez.html compras: ...- [ Translate this page ] ... Otros Peces Eléctricos. Los más conocidos son la Anguila Eléctrica de Sud América Electrophorus electricus, y el pez Gato africano Malopterurus electricus. ... http://www.aquariumofniagara.org/aquarium/electric_eel.htm Electric Eel: ...in shape. Electrophorus electricus is famous for its ability to produce strong electrical currents, reaching 500-650 volts. This ... http://www.scielo.br/scielo.php?script=sci_issuetoc&pid=0001-376520000003&lng=en&nrm=iso An. Acad. Bras. Ci . - vol.72 no.3: ..., . , Choline acetyltransferase detection in normal and denervated electrocyte from Electrophorus electricus (L.) using a Confocal Scanning Optical ... http://fusionanomaly.net/electriceels.html fUSION Anomaly. Electric Eels: ...(8 Cauac (Rain)/8 Kawuq (Rain) - 99/260 - 12.19.8.4.19). electric eel noun A long, eellike freshwater fish (Electrophorus electricus) of northern South America ... http://freshaquarium.about.com/cs/fishspecies/a/commone.htm Common Names of Freshwater Fish - E: Lefua costata Electric Blue Hap - Sciaenochromis ahli Electric Catfish - Malapterurus electricus Electric Eel - Electrophorus electricus Electric Yellow Hap ... http://perso.wanadoo.fr/redris/HTML/prevoteau102.htm La famille des anguilles électriques: ...- [ Translate this page ] ... Une espèce est capable de produire des décharges parfaitement perceptibles par l'homme c'est le Gymnote Electrophorus electricus au nom si explicite. ... http://www.abc.org.br/sjbic/curriculo.asp?consulta=aida AÃda Hassón-Voloch - Membros da ONMC: ...- [ Translate this page ] ... Carlos Chagas Filho sobre o receptor nicotÃnico da acetilcolina, utilizando como modelo biológico o Electrophorus electricus (L.) tendo a seguir trabalhado e ... http://www.szgdocent.org/ff/f-wfish.htm FRESHWATER HABITATS Freshwater fish adapted to murky waters: The Electric Eel (Electrophorus electricus) of South America, however, can generate more than just the low-voltage background field. ... http://www.thekrib.com/Organizations/tfh.html Tropical Fish Hobbiest: Aug 90 Dysichthys coracoideus (Banjo Catfish) TFH Jan 90 Earthworms TFH Jun 81 Echinodurus osiris (Swordplant) TFH Oct 91 Electrophorus electricus (Electric Eel ... http://www.pubmedcentral.nih.gov/articlerender.fcgi?artid=391687 Acetylcholine receptor (from Electrophorus electricus): a ...: Proc Natl Acad Sci US A. 1984 September; 81 (17): 5281 5285 Acetylcholine receptor (from Electrophorus electricus): a comparison of single-channel current ... http://www.petereudenbach.com/proposals/eel.html Electric Eel: Electrophorus Electricus. ... Electric Eel; Electrophorus electricus, actually a fish dwelling in the Amazon and other rivers of South America. ... http://www.amazon.com/exec/obidos/external-search/104-5790685-6250061?mode=blended&keyword=%22Electrophorus%20electricus%22&tag=tabularasa0f www.amazon.com/exec/obidos/external-search/104-5790685-6250061?mode=blended&keyword=%22Electrophorus%20electricus%22&tag=tabularasa0f: Similar pages Akvarielagret - GallerietProtomelas steveni "Taiwan reef". Electrophorus electricus, elÃ¥l. Electrophorus electricus, elÃ¥l. ... http://www.akvarielagret.se/galleri/galleri.html EC.3.1.1.7 Acetylcholinesterase.: Fragment: a4 form. Source: 1. Electrophorus electricus. Electric eel. ... Fragment: a4 form. Source: 1. Electrophorus electricus. Electric eel. ... http://www.biochem.ucl.ac.uk/cgi-bin/cath/SearchHeaders.pl?species=399 List of 3D structures for species: Single-species listing. List of PDB structures for Electric eel (Electrophorus electricus). 1c2b - Electrophorus electricus acetylcholinesterase: ... http://www.enchantedlearning.com/subjects/fish/printouts/Electriceelprintout.shtml Electric Eel Printout- Enchanted Learning Software: Electric Eel Printout. The Electric Eel (Electrophorus electricus) is a long fish that can generate electricity. Zoobooks magazine for kids! ... http://www.fact-index.com/n/na/naked_back_knifefish.html Naked-back knifefish: ...in locating objects and possibly for communication. Genus Electrophorus: Electric eel (Electrophorus electricus). Genus Gymnotus: ... http://www.bms.ed.ac.uk/services/webspace/students/group9/cloning.htm Ion Channels: ...structure. Cloning of a sodium channel (Noda M et al, 1984). Pieces of cloned DNA were obtained from the mRNA of Electrophorus electricus. ... http://www.natureaquarium.it/america/sud/due.htm www.natureaquarium.it: ...- [ Translate this page ] ... Pterophyllum scalare, Symphysodon aequifasciatus haraldi, S. discus, Uaru amphiacanthoides (Cichlidae); Electrophorus electricus (Electrophoridae); Gymnotus ... http://madhaus.utcs.utoronto.ca/~bedinelli/ Marcos Bedinelli: ...- [ Translate this page ] ... Poraquê (Electrophorus electricus)®: Peixe encontrado em bacias ao norte do Amazonas. ... Poraquê" é marca registrada do Electrophorus electricus. ... http://www.biosis.org.uk/ion/results.asp?seek=Electrophorus%20electricus Search results: Request Details. Searching for : Electrophorus electricus. Search Results. ... Organism Name, Group. Electrophorus electricus, Pisces. Search again. ... http://mayoresearch.mayo.edu/mayo/research/staff/publications-listed.cfm?startrow=51&personid=12558630 Publications List: 79. Rosenberry TL, Barnett P, Mays C. Preparation of acetylcholinesterase from the eel Electrophorus electricus and isolation of subunits that contain collagen ... http://www.znaturforsch.com/c53c.htm VZN - Contents Vol. 53c (1998): Choline Acetyltransferase from the Electric Organ of Electrophorus electricus (L.) - Physicochemical Characterization and Immunochemical Identification Key ... http://www.nordiq.net/djurord/cgi-bin/sok.pl?bokstav=e&in=&ordlista=english&start=10&ord=E Sökresultat / Search Results - "E": ...- [ Translate this page ] ... serpent d'eau; anguille électrique La: Anguilla anguilla (Europe), Anguilla bastoniensis (America); Electrophorus electricus; Fam. ... http://www.bentham.org/ppl/ppl10-3.htm Protein & Peptide Letters, Volume 10, No. 3, 2003: ...[Abstract]. Arrhenius Analysis of the Electrophorus Electricus Acetylcholinesterase-Catalyzed Hydrolysis of Acetylthiocholine Pp.321-324. ... http://www.elasmo.de/elekbz1-99.htm DEG - ELASMOSKOP Nr. 1/99: ...- [ Translate this page ] ... Elektrogenese). Neben dem Zitteraal (Electrophorus electricus) und Zitterwels (Malapterus electricus) gehören auch Zitterrochen (Fam. ... http://www.fishbase.org.ph/References/SpeciesUsedRefList.cfm?refno=7494 List of Species Treated in Reference and Used in FishBase: Eigenmannia virescens (Valenciennes, 1842), Eigenmannia virescens. Electrophorus electricus (Linnaeus, 1766), Electrophorus electricus. ... http://brenda.bc.uni-koeln.de/ectree/download_pdbs.php4?ec=3. 3.1.1.1 1AUO Pseudomonas fluorescens 3.1.1.1 1AUR Pseudomonas ...: ...- [ Translate this page ] ... Torpedo californica 3.1.1.7 1AMN Torpedo californica 3.1.1.7 1AX9 Torpedo californica 3.1.1.7 1B41 Homo sapiens 3.1.1.7 1C2B Electrophorus electricus 3.1.1.7 ... http://www.ishc.net/summary/1997.12/summary.html Summary -December 1997-: Title Desmin and actin filaments in membrane-cytoskeletal preparations of the electric tissue of Electrophorus electricus, L. Author Mermelstein CS; Benchimol M ... http://sci-toys.com/scitoys/scitoys/biology/electric_fish/electric_fish.html Chapter 8: Biology: Some of the better known electric fish are the South American electric eel Electrophorus electricus, and the African electric catfish Malopterurus electricus. ... http://www.bio.davidson.edu/Courses/anphys/1999/Hillmann/aggression.html signaling in aggression: In one record of a complete interaction between an electric eel (Electrophorus electricus) and a Gymnotus carapo, a unique signaling sequence took place. ... http://stevens.scripps.edu/ESGDB/EC_3.html PDB id code: 1C2B, ..... electrophorus electricus acetylcholinesterase, acetylcholinesterase, electrophorus electricus. 2DFP, MIS,MES,NAG, ..... ... http://www.britannica.com/eb/index?search=electronic%20trading Encyclopædia Britannica: ...electrophoresis (chem.), electrophorus (device), Electrophorus electricus (fish): see electric eel, electrophotography (phot.), electrophysiology, ... http://www.aquafind.com/boards/message.php?id=11628&brd=comorn Aquafind - Aquaculture, seafood, tropical fish resource.: Learius Pictus 4 15.00 4 Achara Corbata Learius Pictus 20 5.00 3 Achara Común Perrunichtys Perruño 40 2.00 3 Anguillas Electrophorus Electricus 10 5.00 4 ... http://tolweb.org/tree?group=Gymnotiformes&contgroup=Ostariophysi Gymnotiformes: ...top. Electrophorus electricus, the electric eel, is here included in the family Gymnotidae to emphasize its close relationship with Gymnotus. ... http://cimbad.mnhn.fr/mnhn/phg/equipe1/glevi/passeen.htm Giovanni Levi – Parcours Scientifique: ...- [ Translate this page ] ... de ces molécules vient de leur distribution au niveau des synapses cholinergiques et de l’organe électrique de l’anguille Electrophorus electricus. ... http://www.seaworld.org/animal-info/info-books/bony-fish/diet.htm Diet and Eating Habits: ...volts of electricity. The South American electric eel (Electrophorus electricus) can produce up to 650 volts of electricity. f. Some ... http://astral.berkeley.edu/asteroids-1.65/sequences/sf/c.69.1.fa d1amn__ c.69.1.1 (-) Acetylcholinesterase {Electric ray (Torpedo ...: ...eel (Electrophorus electricus)} dpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldatt fqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggfy ... http://scienceweek.com/2001/sw010323.htm ScienceWeek Archive: Researchers now report the 3-dimensional structure of the voltage-sensitive sodium channel of the eel Electrophorus electricus. ... http://www.kazusa.or.jp/cyano/Synechocystis/blast2/nr/slr8023.html Synechocystis: BLAST2 result: 251 3e-65 pdb|1C7J|A Chain A, Pnb Esterase 56c8 250 6e-65 pdb|1C2O|A Chain A, Electrophorus Electricus Acetylcholinesteras... 250 ... http://www.visualsunlimited.com/browse/vu228/dirpage.html Visuals Unlimited Stock Photography: ...vu228069 - Electric Eel (Electrophorus electricus) Amazon River Basin, Brazil, South America; vu228070 - Gallstones from an opened gallbladder. ... http://www.wku.edu/~smithch/wallace/S012.htm On Some Fishes Allied to Gymnotus by Alfred Russel Wallace: Contrary to what Wallace says, not only the Electric eel, Electrophorus electricus (referred to by Wallace as Gymnotus electricus), has electrical properties. ... http://jb.oupjournals.org/cgi/content/abstract/108/6/947 JB -- Abstracts: Aoshima 108 (6): 947: ARTICLES. Acetylcholine receptor-mediated membrane current in oocytes injected with Electrophorus electricus mRNA: analyses of nicotine, succinylcholine, and ... http://habitatnews.nus.edu.sg/guidebooks/freshfish/text/110a.htm Search the web for further information on Electrophorus electricus Use this form to make suggestions, correct errors, and contribute/submit pictures or content for this species profile. |
