|
|
|
|
|
|
Web Resources for Galaxias anomalusFishBase profile for Galaxias anomalus
http://www.niwa.cri.nz/rc/freshwater/fishatlas/species/flathead_galaxias.htm NIWA Atlas of NZ Freshwater Fishes -- Roundhead galaxias (Galaxias ...: Atlas of New Zealand Freshwater Fishes, ... http://www.rsnz.org/publish/nzjmfr/1999/12.php Moore et al.--Spawning site selection in galaxiids: Spawning site selection by two galaxiid fishes, Galaxias anomalus and G. depressiceps, in tributaries of the Taieri River, South Island, New Zealand. ... http://www.rsnz.org/publish/jrsnz/1996/67.php McDowall & Wallis - New and redescribed Galaxias from Otago and ...: ...further study. Keywords: Galaxias; Galaxias anomalus; Galaxias vulgaris; new species; systematics; Taieri River; Otago; Southland. (c ... http://www.fishbase.org/Summary/SpeciesSummary.cfm?ID=53170&genusname=Galaxias&speciesname=anomalus Species Summary: Galaxias anomalus, You can sponsor this page, ... http://www.fishbase.org/Nomenclature/NominalSpeciesList.cfm?family=Galaxiidae Information by Country - Search Result: Saxilaga anguilliformis Scott, 1936, Neochanna cleaveri, 007300. Galaxias anomalus Stokell, 1959, Galaxias anomalus, 026282. Neochanna ... http://www.funet.fi/pub/sci/bio/life/pisces/actinopterygii/osmeriformes/galaxioidea/galaxiidae/galaxiinae/galaxias/ Galaxias: ...hesperius Whitley, 1944; (synonym) Galaxias vulgaris Stokell, 1949 Galaxias anomalus Stokell, 1959; (synonym) Galaxias zebratus McDowall ... http://www.nzfreshwater.org/threat_list.txt Common name Scientific name Ranking Qualifiers Alpine galaxias ...: Data deficient - Redfin bully Gobiomorphus huttoni Not threatened - Roundhead galaxias Galaxias anomalus Gradual Decline Extreme fluctuations Shortfin eel ... http://www.nzfreshwater.org/fish_dic.txt NEW ZEALAND NATIVE FRESHWATER FISH DICTIONARY. <a href="<a href ...: Galaxias "Teviot" Possible new non-diadromous galaxias - Galaxias "Von sp." Possible new non-diadromous galaxias - Galaxias anomalus Roundhead galaxias ... http://www.ergo-light.com/ERGO/CGI/prot.cgi?prot=RRC00609&user= Protein Page for RRC00609 from Rhodobacter capsulatus: Percopsis transmontana, pirnr|NF00041738, 3.13e-22, 732, NADH dehydrogenase subunit 5 (Fragment), Galaxias anomalus, pirnr|NF01010387, ... http://www.scielo.cl/scielo.php?script=sci_arttext&pid=S0717-65382002000200013&lng=en&nrm=iso&tlng=es Gayana (Concepci - <I>THE PUYE </I>GALAXIAS<I> </I>GLOBICEPS<I> ...: ...- [ Translate this page ] ... Spawning site selection by two galaxiids fishes, Galaxias anomalus and Galaxias depressiceps, in tributaries of the Taieri River, South Island, New Zealand. ... http://genstyle.imed.jussieu.fr/chaosgame/affichage_esp_list.php?lettres=g Alphabetical List of Species: ...- [ Translate this page ] ... Galathealinum brachiosum (1). Galax urceolata (2). Galaxea fascicularis (1). Galaxias anomalus (1). Galaxias brevipinnis (2). Galaxias depressiceps (1). ... http://fishdb.sinica.edu.tw/2001new/classification/class_new.asp?fa=Galaxiidae&fach=%E5%8D%97%E4%B9%B3%E9%AD%9A%E7%A7%91 Folder Navigation: ...å?—ä¹³éšå±¬Ä„@Genus Galaxias 33şŘ. 阿爾派å?—ä¹³éšÄ„@Galaxias alpinus ç³™å?—ä¹³éšÄ„@Galaxias anomalus 銀å?—ä¹³éšÄ„@Galaxias argenteus å?—ä¹³éšÄ„ ... http://genoma.unsam.edu.ar/projects/tca/blast_dir/nr/tca-06n15.b1MT.br BLASTX 2.1.3 [Apr-1-2001] Reference: Altschul, Stephen F., Thomas ...: GW W EF VF Sbjct: 6 WGDRSVLGYVLAYLVGVLVTAGLFWGGWYEGSWTVVDEFKDLSVF 50 >gb|AAK53189.1| (AF267385) NADH dehydrogenase subunit 6 [Galaxias anomalus] Length = 173 ... http://www.infobiogen.fr/db/acnuc/hovergen/genomic/index/SPECIES JD RACINE _< UNCLASSIFIED × Ã2 _< ÿÿÿü UNCLASSIFIED. ...: ...- [ Translate this page ] ... Äá _AÔ GALAXIAS FASCIATUS « Äâ _AÖ N GALAXIAS AURATUS ¬ Äã _AØ Ø GALAXIAS ZEBRATUS  Ää _AÚ GALAXIAS ANOMALUS ® Äå _AÃœ Ç ... http://www.infobiogen.fr/db/index-acnuc/HOVERGEN_44/protein/index/SPECIES OH RACINE Pâ€?Þ UNCLASSIFIED Pâ€?à ÿÿÿü UNCLASSIFIED. ...: ...- [ Translate this page ] ... Pšö : GALAXIAS SP. 'TEVIOT' JM Pšø … GALAXIAS ANOMALUS JN Pšú * GALAXIAS ELDONI JO Pšü – GALAXIAS SP. 'NORTHERN' JP ... http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB1427.blastp getblast.pl beck@molgen-mpg.de: 83 9e-15 SP_TREMBL:O21067 O21067 lejeunea cavifolia. nadh dehydrogenase s... 83 9e-15 SP_TREMBL:Q959A5 Q959a5 galaxias anomalus. nadh dehydrogenase su... ... http://bioinfo.hku.hk/db/hovergen/protein/index/id.log warning appel faire_synonyme trouve deja existant ailleurs ds ...: ...- [ Translate this page ] ... GALAXIAS POSTVECTIS Libel: shortjaw kokopu 30.....GALAXIAS ANOMALUS 30.....GALAXIAS DEPRESSICEPS 30 ... http://123d.ncifcrf.gov/123D+/pblast/123D+AAAa00Q0a Search the web for further information on Galaxias anomalus Use this form to make suggestions, correct errors, and contribute/submit pictures or content for this species profile. |
