|
|
|
|
|
|
Web Resources for Galaxias eldoniFishBase profile for Galaxias eldoni
http://www.niwa.cri.nz/rc/freshwater/fishatlas/species/galaxiidae.htm NIWA Atlas of NZ Freshwater Fishes -- Whitebait and Mudfish ...: Galaxias cobitinis (lowland longjaw galaxias) Galaxias depressiceps (flathead galaxias) Galaxias divergens (dwarf galaxias) Galaxias eldoni (Eldons galaxias ... http://www.fishbase.org/Summary/SpeciesSummary.cfm?id=53174 Species Summary: Galaxias eldoni, You can sponsor this page, ... http://www.fishbase.org/Nomenclature/NominalSpeciesList.cfm?family=Galaxiidae Information by Country - Search Result: Galaxias dubius Gilchrist & Thompson, 1917, Galaxias zebratus, 003563. Galaxias eldoni McDowall, 1997, Galaxias eldoni, 026282. Paragalaxias ... http://www.funet.fi/pub/sci/bio/life/pisces/actinopterygii/osmeriformes/galaxioidea/galaxiidae/galaxiinae/galaxias/ Galaxias: Galaxias depressiceps McDowall & Wallis, 1996 Galaxias divergens Stokell, 1959 Galaxias eldoni McDowall, 1997 ?Galaxias elongatus Lahille, 1915 ... http://www.biosis.org.uk/ion/results.asp?seek=Galaxias%20eldoni Search results: Index To Organism Names: Search Results. Request Details. Searching for : Galaxias eldoni. Search Results. ... Organism Name, Group. Galaxias eldoni, Pisces. Search again. ... http://www.nzfreshwater.org/threat_list.txt Common name Scientific name Ranking Qualifiers Alpine galaxias ...: Galaxias pullus Gradual Decline Conservation dependent Dwarf galaxias Galaxias divergens Gradual Decline - Eldon's galaxias Galaxias eldoni Gradual decline ... http://www.nzfreshwater.org/fish_dic.txt NEW ZEALAND NATIVE FRESHWATER FISH DICTIONARY. <a href="<a href ...: Galaxias depressiceps Flathead galaxias - Galaxias divergens Dwarf galaxias - Galaxias eldoni Eldon’s galaxias - Galaxias fasciatus Banded kokopu Para ... http://www.ergo-light.com/ERGO/CGI/prot.cgi?prot=RRC00609&user= Protein Page for RRC00609 from Rhodobacter capsulatus: 5, Saurida undosquamis, pirnr|NF00041757, 4.47e-22, 728, NADH dehydrogenase subunit 5 (Fragment), Galaxias eldoni, pirnr|NF00467189, 4.60 ... http://www.rsnz.org/publish/jrsnz/1997/29.php <a name="RTFToC17">The Journal of the Royal Society of New Zealand ...: Foraminiferal associations 21. Fossil fauna 67. Fossil fish 193. Futuna 235. Galaxias eldoni 199. Galaxias gracilis 223. Galaxias pullus 199. Galaxiidae 193, 199. ... http://pubs.nrc-cnrc.gc.ca/cgi-bin/rp/rp2_abst_e?cjfas_f98-082_55_ns_nf_cjfas8-98 NRC Research Press: Canadian Journal of Fisheries and Aquatic ...: ...- [ Translate this page ] ... travelled by Nesameletus ornatus mayfly nymphs in stream channels (current velocity 18 cm·s -1 ) with either Eldon's galaxias (Galaxias eldoni), brown trout ... http://genstyle.imed.jussieu.fr/chaosgame/affichage_esp_list.php?lettres=g Alphabetical List of Species: ...- [ Translate this page ] ... Galaxias anomalus (1). Galaxias brevipinnis (2). Galaxias depressiceps (1). Galaxias eldoni (1). Galaxias gollumoides (1). Galaxias maculatus (5). ... http://www.fishbase.org.ph/map/PointData.asp?genus=Galaxias&species=eldoni 53174 Galaxias eldoni McDowall, 1997 Galaxiidae Galaxiids ...: ...] > 53174 Galaxias eldoni McDowall, 1997 Galaxiidae Galaxiids Galaxiinae Osmeriformes Actinopterygii (ray-finned fishes) Oceania: New Zealand. http://www.fishbase.org.ph/xml/comnamesxml.cfm?genus=Galaxias&species=eldoni&type= Successful connection, 1 record(s) found. Galaxias eldoni 53174 ...: ...] > Successful connection, 1 record(s) found. Galaxias eldoni 53174 埃æ°?å?—ä¹³éš China Main Mandarin Chinese Vernacular http://genoma.unsam.edu.ar/projects/tca/blast_dir/nr/tca-06n15.b1MT.br BLASTX 2.1.3 [Apr-1-2001] Reference: Altschul, Stephen F., Thomas ...: GW W EF VF Sbjct: 82 WGDRSVLGYVLVYFVGVLVTAGLFWGGWYEGSWTVVDEFKDLSVF 126 >gb|AAK53191.1| (AF267386) NADH dehydrogenase subunit 6 [Galaxias eldoni] Length = 173 ... http://fishdb.sinica.edu.tw/2001new/classification/class_new.asp?fa=Galaxiidae&fach=%E5%8D%97%E4%B9%B3%E9%AD%9A%E7%A7%91 Folder Navigation: Ä„@Galaxias cleaveri å¹³é å?—ä¹³éšÄ„@Galaxias depressiceps 廣佈å?—ä¹³éšÄ„@Galaxias divergens 埃æ°?å?—ä¹³éšÄ„@Galaxias eldoni 帶紋å?—ä¹³éšÄ„@Galaxias ... http://www.fore.canterbury.ac.nz/euan/beech/allibone.htm Body: Huryn (1998) in the only systematic study of native fish production showed, for the non-migratory fish Galaxias eldoni that the population utilised ... http://www.bioone.org/bioone/?request=get-document&issn=0022-3395&volume=087&issue=05&page=1225 Mermithid Nematode Infections and Drift in the Mayfly <IT> ...: ...drift (less likely to be predated by fish) in a stream containing brown trout (Sutton Stream) or one containing the native fish Galaxias eldoni McDowall, as ... http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB1427.blastp getblast.pl beck@molgen-mpg.de: 85 2e-15 SP_TREMBL:Q959A1 Q959a1 galaxias eldoni. nadh dehydrogenase subu... ... nadh dehydrogena... 85 2e-15 SP_TREMBL:Q959A3 Q959a3 galaxias eldoni. ... http://www.infobiogen.fr/db/acnuc/hovergen/genomic/index/SPECIES JD RACINE _< UNCLASSIFIED × Ã2 _< ÿÿÿü UNCLASSIFIED. ...: ...- [ Translate this page ] ... Äâ _AÖ N GALAXIAS AURATUS ¬ Äã _AØ Ø GALAXIAS ZEBRATUS  Ää _AÚ GALAXIAS ANOMALUS ® Äå _AÃœ Ç GALAXIAS ELDONI ¯ Äæ _AÞ ... http://www.infobiogen.fr/db/index-acnuc/HOVERGEN_44/protein/index/SPECIES OH RACINE Pâ€?Þ UNCLASSIFIED Pâ€?à ÿÿÿü UNCLASSIFIED. ...: ...- [ Translate this page ] ... Pšö : GALAXIAS SP. 'TEVIOT' JM Pšø … GALAXIAS ANOMALUS JN Pšú * GALAXIAS ELDONI JO Pšü – GALAXIAS SP. 'NORTHERN' JP ... http://www.blackwell-synergy.com/links/doi/10.1046/j.1365-2427.2003.01043.x/full/ The influence of scale and geography on relationships between ...: ...and restricted distributions of native galaxiid fishes (Galaxias depressicepsin northern and western parts of the catchment, Galaxias eldoni in southern and ... http://fishbase.sinica.edu.tw/identification/specieslist.cfm?areacode=&famcode=79 Family - Search Result: Galaxias depressiceps, 8.2 FL. Galaxias divergens, Dwarf galaxias, Galaxias eldoni, 8.4 FL. Galaxias fasciatus, Banded kokopu, Galaxias fontanus, Swan galaxias, 9.0 SL. ... http://bioinfo.hku.hk/db/hovergen/protein/index/id.log warning appel faire_synonyme trouve deja existant ailleurs ds ...: ...- [ Translate this page ] ... ANOMALUS 30.....GALAXIAS DEPRESSICEPS 30.....GALAXIAS ELDONI 30.....GALAXIAS ... http://123d.ncifcrf.gov/123D+/pblast/123D+AAAa00Q0a Search the web for further information on Galaxias eldoni Use this form to make suggestions, correct errors, and contribute/submit pictures or content for this species profile. |
